PDB entry 6qrk

View 6qrk on RCSB PDB site
Description: high pressure structure of bovine insulin (200 mpa)
Deposited on 2019-02-19, released 2019-03-06
The last revision was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6qrkA (A:)
giveqccasvcslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6qrkB (B:)
fvnqhlcgshlvealylvcgergffytpka