PDB entry 6qqk

View 6qqk on RCSB PDB site
Description: Room temperature structure of blue light-irradiated AtPhot2LOV2 recorded after an accumulated dose of 34 kGy
Class: plant protein
Keywords: Room temperature macromolecular crystallography, cryo-crystallography, specific radiation damage, time-resolved crystallography, PLANT PROTEIN
Deposited on 2019-02-18, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phototropin-2
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: PHOT2, CAV1, KIN7, NPL1, At5g58140, K21L19.6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P93025
  Domains in SCOPe 2.08: d6qqka_
• Heterogens: FMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6qqkA (A:)
  meknfvisdprlpdnpiifasdsflelteysreeilgrncrflqgpetdqatvqkirdai
  rdqreitvqlinytksgkkfwnlfhlqpmrdqkgelqyfigvqldgefipnpllgldstr
  tghhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6qqkA (A:)
  knfvisdprlpdnpiifasdsflelteysreeilgrncrflqgpetdqatvqkirdaird
  qreitvqlinytksgkkfwnlfhlqpmrdqkgelqyfigvq