PDB entry 6qp3

View 6qp3 on RCSB PDB site
Description: Crystal structure of the PLP-bound C-S lyase from Bacillus subtilis (strain 168)
Class: lyase
Keywords: pyridoxal phosphate binding, Cysteine-S-conjugate beta-lyase, LYASE
Deposited on 2019-02-13, released 2020-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine beta-lyase PatB
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: patB, BSU31440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qp3a_
  • Chain 'B':
    Compound: Cystathionine beta-lyase PatB
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: patB, BSU31440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qp3b_
  • Chain 'C':
    Compound: Cystathionine beta-lyase PatB
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: patB, BSU31440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qp3c_
  • Chain 'D':
    Compound: Cystathionine beta-lyase PatB
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: patB, BSU31440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qp3d_
  • Heterogens: ACT, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qp3A (A:)
    mnfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgy
    ttpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvyt
    pfyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsre
    dllklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniag
    lqasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmn
    eaeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgg
    egfmrlnagcslatlqdglrrikaals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qp3B (B:)
    mnfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgy
    ttpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvyt
    pfyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsre
    dllklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniag
    lqasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmn
    eaeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgg
    egfmrlnagcslatlqdglrrikaals
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qp3B (B:)
    nfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgyt
    tpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvytp
    fyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsred
    llklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniagl
    qasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmne
    aeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgge
    gfmrlnagcslatlqdglrrikaals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6qp3C (C:)
    mnfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgy
    ttpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvyt
    pfyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsre
    dllklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniag
    lqasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmn
    eaeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgg
    egfmrlnagcslatlqdglrrikaals
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qp3C (C:)
    mnfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgy
    ttpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvyt
    pfyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsre
    dllklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniag
    lqasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmn
    eaeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgg
    egfmrlnagcslatlqdglrrikaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6qp3D (D:)
    mnfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgy
    ttpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvyt
    pfyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsre
    dllklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniag
    lqasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmn
    eaeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgg
    egfmrlnagcslatlqdglrrikaals
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qp3D (D:)
    nfdkreerlgtqsvkwdktgelfgvtdalpmwvadmdfrapeaitealkerldhgifgyt
    tpdqktkdavcgwmqnrhgwkvnpesitfspgvvtalsmavqaftepgdqvvvqppvytp
    fyhmvekngrhilhnpllekdgayaidfedletklsdpsvtlfilcnphnpsgrswsred
    llklgelclehgvtvvsdeihsdlmlyghkhtpfaslsddfadisvtcaapsktfniagl
    qasaiiipdrlkrakfsaslqrnglgglnafavtaieaayskggpwldelityieknmne
    aeaflstelpkvkmmkpdasyliwldfsayglsdaelqqrmlkkgkvilepgtkygpgge
    gfmrlnagcslatlqdglrrikaals