PDB entry 6qne

View 6qne on RCSB PDB site
Description: Y102G mutated sulfur oxygenase reductase from Acidianus ambivalens
Class: oxidoreductase
Keywords: sulfur oxygenase reductase, 2-his-1-carboxylate facial triad, cysteine persulphuration, biogeochemical sulfur cycle, oxidoreductase
Deposited on 2019-02-11, released 2020-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus ambivalens [TaxId:2283]
    Gene: sor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29082 (Start-307)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6qnea_
  • Chain 'B':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus ambivalens [TaxId:2283]
    Gene: sor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29082 (Start-307)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6qneb_
  • Chain 'C':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus ambivalens [TaxId:2283]
    Gene: sor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29082 (Start-307)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6qnec_
  • Chain 'D':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus ambivalens [TaxId:2283]
    Gene: sor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29082 (Start-307)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6qned_
  • Chain 'E':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus ambivalens [TaxId:2283]
    Gene: sor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29082 (Start-307)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6qnee_
  • Chain 'F':
    Compound: Sulfur oxygenase/reductase
    Species: Acidianus ambivalens [TaxId:2283]
    Gene: sor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29082 (Start-307)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d6qnef_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qneA (A:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qneA (A:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qneB (B:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qneB (B:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6qneC (C:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qneC (C:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6qneD (D:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qneD (D:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6qneE (E:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qneE (E:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6qneF (F:)
    mpkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygg
    akmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeii
    yanmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedai
    vrtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpe
    akntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegt
    fwreylnenawrhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qneF (F:)
    pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
    kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
    anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
    rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
    kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
    wreylne