PDB entry 6qlx

View 6qlx on RCSB PDB site
Description: Cathepsin-K in complex with fluoro-oxa-azabicyclo[3.3.0]octanyl containing inhibitor
Class: hydrolase
Keywords: inhibitor complex, lysosomal cysteine proteinase, HYDROLASE
Deposited on 2019-02-01, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qlxa_
  • Heterogens: HKH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6qlxA (A:)
rapdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvse
ndgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnek
alkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwi
iknswgenwgnkgyilmarnknnacgianlasfpkm