SCOPe 2.08: Structural Classification of Proteins

PDB entry 6qlv

View 6qlv on RCSB PDB site
Description: Crystal structure of W200H UbiX in complex with a geranyl-FMN N5 adduct
Class: transferase
Keywords: UbiX Prenyltransferase Flavin binding, TRANSFERASE
Deposited on 2019-02-01, released 2019-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlva_
Chain 'B':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8 (21-End)
Domains in SCOPe 2.08: d6qlvb_
Chain 'C':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvc_
Chain 'D':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8 (21-End)
Domains in SCOPe 2.08: d6qlvd_
Chain 'E':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlve_
Chain 'F':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvf_
Chain 'G':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvg_
Chain 'H':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvh_
Chain 'I':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvi_
Chain 'J':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvj_
Chain 'K':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvk_
Chain 'L':
Compound: Flavin prenyltransferase UbiX
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: ubiX, C0044_29760, C8257_05245, CAZ10_26235, CGU42_07325, DT376_15100, DZ940_19110, DZ962_23875, NCTC13719_00955, PAERUG_E15_London_28_01_14_05236, PAMH19_1010, RW109_RW109_01660
Database cross-references and differences (RAF-indexed):
- Uniprot A0A072ZCW8
Domains in SCOPe 2.08: d6qlvl_
Heterogens: HZZ, FMN, ACT, NA, HJN, PO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6qlvA (A:)
mhhhhhhssgvdlgtenlyqsmsgperitlamtgasgaqyglrlldclvqeerevhflis
kaaqlvmatetdvalpakpqamqaflteycgaaagqirvfgqndwmappasgssapnamv
icpcstgtlsavatgacnnlieraadvalkerrplvlvpreapfssihlenmlklsnlga
vilpaapgfyhqpqsvedlvdfvvarilntlgipqdmlprhgeqhlvsde