PDB entry 6qjy

View 6qjy on RCSB PDB site
Description: solution nmr structure of a mutant major ampullate spidroin 1 n- terminal domain
Deposited on 2019-01-27, released 2019-09-11
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major ampullate spidroin 1
    Species: Euprosthenops australis [TaxId:332052]
    Gene: MASP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05H60 (4-134)
      • expression tag (0-3)
      • engineered mutation (19)
      • engineered mutation (23)
      • engineered mutation (40)
      • engineered mutation (47)
      • engineered mutation (76)
      • engineered mutation (100)
      • expression tag (135-136)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6qjyA (A:)
gsgnshttpwtnpglaenflnsflqglssmpgftasqlddlstiaqslvqsiqslaaqgr
tspnklqalnmafasslaeiaaseegggslstktssiasalsnaflqttgvvnqpfinei
tqlvsmfaqagmndvsa