PDB entry 6qjk

View 6qjk on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
Class: signaling protein
Keywords: pdz domain, SIGNALING PROTEIN
Deposited on 2019-01-24, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78352
      • engineered mutation (27)
    Domains in SCOPe 2.07: d6qjka_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6qjkA (A:)
edipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvng
vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak

    Sequence, based on observed residues (ATOM records): (download) 
    >6qjkA (A:)
dipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfea