PDB entry 6qjk
View 6qjk on RCSB PDB site
Description: Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
Class: signaling protein
Keywords: pdz domain, SIGNALING PROTEIN
Deposited on
2019-01-24, released
2019-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-04-24, with a file datestamp of
2019-04-19.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Disks large homolog 4
Species: Homo sapiens [TaxId:9606]
Gene: DLG4, PSD95
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6qjka_ - Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>6qjkA (A:)
edipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvng
vdlrnasheqaaialknagqtvtiiaqykpeeysrfeak
Sequence, based on observed residues (ATOM records): (download)
>6qjkA (A:)
dipreprrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfea