PDB entry 6qj7

View 6qj7 on RCSB PDB site
Description: Difluorophenyl diacylhydrazides: Potent inhibitors of Serum- and Glucocorticoid-inducible Kinase 1 (SGK1)
Class: transferase
Keywords: cAMP-dependent protein kinase A (PKA), TRANSFERASE
Deposited on 2019-01-23, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qj7a_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: PKIA, PRKACN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qj7b_
  • Heterogens: J4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qj7A (A:)
    mgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvml
    vkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qj7A (A:)
    esvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamk
    ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl
    rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
    grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
    gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
    pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qj7B (B:)
    ttyadfiasgrtgrrnaihd