PDB entry 6qii

View 6qii on RCSB PDB site
Description: Xenon derivatization of the F420-reducing [NiFe] hydrogenase complex from Methanosarcina barkeri
Class: oxidoreductase
Keywords: [NiFe] containing hydrogenase, reversible oxidation of dihydrogen, oxygen sensitive, methanogenic acetoclastic Archaea, oxidoreductase
Deposited on 2019-01-19, released 2019-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme F420 hydrogenase subunit alpha
    Species: Methanosarcina barkeri MS [TaxId:1434108]
    Database cross-references and differences (RAF-indexed):
    • PDB 6QII (0-436)
    Domains in SCOPe 2.08: d6qiia_
  • Chain 'B':
    Compound: Coenzyme F420 hydrogenase subunit beta
    Species: Methanosarcina barkeri MS [TaxId:1434108]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Coenzyme F420 hydrogenase subunit gamma
    Species: Methanosarcina barkeri MS [TaxId:1434108]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, 144, FES, XE, BU3, NFU, FE, MG, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6qiiA (A:)
tkvveispttrleghskltlkvndqgivergdwlsitpvrgieklaigktmeqvpkiasr
vcgicpiahtlasteameasigceiptdakllriilhaanrihshalhnililpdfyipg
tekkfnlfaneqparsvmarivrireiaqtiaaiaggeaihpsnpriggmyhnvsprakq
kmadlakeclvlvheqmefmldvirnmqnrefvevggkqiplpkklgyhnqgvmatapmy
gssslddnptwdftrwketrpwdwymgevtidledpsypiggttkvgtkanpqmesctgv
ptydgqpvevgprarlatfknfdekgtfaqhiarqmeypdccytilncldnlntsgkvla
dhipqgdgsmgwaaneaprgsnihlarvkdgkvrwydmlvpttwnfptcsraltgapwqi
aemvvraydpcvscath

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.