PDB entry 6qe8

View 6qe8 on RCSB PDB site
Description: Crystal structure of Aspergillus niger GH11 endoxylanase XynA in complex with xylobiose epoxide activity based probe
Class: hydrolase
Keywords: hydrolase
Deposited on 2019-01-07, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55329 (Start-210)
      • conflict (76)
    Domains in SCOPe 2.07: d6qe8a_
  • Heterogens: HZB, MES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qe8A (A:)
    mkvtaafagllvtafaapvpepvlvsrsaginyvqnyngnlgdftydesagtfsmywedg
    vssdfvvglgwttgssnaitysaeysasgsssylavygwvnypqaeyyivedygdynpcs
    satslgtvysdgstyqvctdtrtnepsitgtstftqyfsvrestrtsgtvtvanhfnfwa
    qhgfgnsdfnyqvmaveawsgagsasvtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qe8A (A:)
    aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
    gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
    tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
    iss