PDB entry 6qdz

View 6qdz on RCSB PDB site
Description: P38 alpha complex with AR117045
Class: signaling protein
Keywords: Inhibitor, Complex, Kinase, SIGNALING PROTEIN
Deposited on 2019-01-03, released 2020-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qdza_
  • Heterogens: HYK, I46, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qdzA (A:)
    gsmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qdzA (A:)
    rptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnniltddhvqfliy
    qilrglkyihsadiihrdlkpsnlavnedcelkildfgatrwyrapeimlnwmhynqtvd
    iwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqm
    pkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydq
    sfesrdllidewksltydevisfvppp