PDB entry 6qdu

View 6qdu on RCSB PDB site
Description: Crystal structure of 14-3-3sigma in complex with a RapGef2 pT740 phosphopeptide inhibited by semi-synthetic fusicoccane FC-NCPC
Class: chaperone
Keywords: Neuron Regeneration, PPI, phosphorylation, CHAPERONE
Deposited on 2019-01-02, released 2020-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d6qdua1, d6qdua2
  • Heterogens: HY5, TPO, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qduA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qduA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneeekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrv
    fylkmkgdyyrylaevatdkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
    yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt