PDB entry 6qcb

View 6qcb on RCSB PDB site
Description: crystal structure of human cathepsin d in complex with macrocyclic inhibitor 9
Deposited on 2018-12-27, released 2020-01-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSD, CPSD
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cathepsin d
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSD, CPSD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO3, HWE, DMS, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6qcbA (A:)
gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
sdksstyvkngtsfdihygsgslsgylsqdtvsvpcq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6qcbB (B:)
gvkverqvfgeatkqpgitfiaakfdgilgmayprisvnnvlpvfdnlmqqklvdqnifs
fylsrdpdaqpggelmlggtdskyykgslsylnvtrkaywqvhldqvevasgltlckegc
eaivdtgtslmvgpvdevrelqkaigavpliqgeymipcekvstlpaitlklggkgykls
pedytlkvsqagktlclsgfmgmdipppsgplwilgdvfigryytvfdrdnnrvgfaeaa
r