PDB entry 6qbz

View 6qbz on RCSB PDB site
Description: Solution structure of the N-terminal domain of the Staphylococcus aureus Hibernation Promoting Factor
Class: ribosomal protein
Keywords: Hibernation promoting factor, Staphylococcus aureus, 100S ribosome, RIBOSOMAL PROTEIN
Deposited on 2018-12-25, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome hibernation promoting factor
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: hpf, raiA, BN1321_170086, BTN44_08780, C0J46_03720, C7Q89_05535, CSC83_13900, CSC87_08515, CV021_09125, EP54_02760, EQ90_03750, ERS072840_01629, HMPREF3211_01097, NCTC10654_00858, NCTC11940_00726, NCTC13131_00825, NCTC13196_00432, NCTC13812_00784, NCTC6133_00902, NCTC7878_03405, NCTC9944_00832, RK64_04495, SAMEA1466939_00154, SAMEA1469870_00863, SAMEA1531701_00565, SAMEA1708664_00330, SAMEA1708674_00592
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6qbza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qbzA (A:)
    mirfeihgdnltitdairnyieekigkleryfndvpnavahvkvktysnsatkievtipl
    knvtlraeernddlyagidlinnklerqvrkyktrinrksrdrgdqevfv