PDB entry 6qbj

View 6qbj on RCSB PDB site
Description: structure determination of transmembrane- c-terminal fragment of ul49.5 protein from bovine herpesvirus 1 by nmr spectroscopy and molecular dynamics
Deposited on 2018-12-21, released 2019-02-27
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein N
    Species: Bovine alphaherpesvirus 1, synthetic [TaxId:10320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q89806 (0-39)
      • conflict (10)
      • conflict (21)
      • conflict (25)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6qbjA (A:)
    vvfyvaltavlvavalyayglafrllgasgpnkkesrgrg