PDB entry 6qay

View 6qay on RCSB PDB site
Description: structural investigation of the tasa anchoring protein tapa from bacillus subtilis
Deposited on 2018-12-20, released 2020-01-29
The last revision was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TasA anchoring/assembly protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tapA, yqhD, yqxM, BSU24640
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6qayA (A:)
afhdietfdvslqtckdfqhtdknchydkrwdqsdlhisdqtdtkgtvcspfalfavlen
tgeklkkskwkwelhklenarkplkdgnviekgfvsnqigdslykietkkkmkpgiyafk
vykpagypangstfewsepmrlakcde

    Sequence, based on observed residues (ATOM records):
    >6qayA (A:)
rwdqsdlhisdqtdtkgtvcspfalfavlentgeklkkskwkwelhklenarkplkdgnv
iekgfvsnqigdslykietkkkmkpgiyafkvykpagypangstfewsepmrlakcde