PDB entry 6q9h
View 6q9h on RCSB PDB site
Description: HDM2 (17-111, WILD TYPE) COMPLEXED WITH COMPOUND 11 AT 2.0A; Structural states of Hdm2 and HdmX: X-ray elucidation of adaptations and binding interactions for different chemical compound classes
Class: ligase
Keywords: PPI with p53, inhibitor complex, cell cycle, LIGASE
Deposited on
2018-12-18, released
2019-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-07-24, with a file datestamp of
2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase Mdm2
Species: Homo sapiens [TaxId:9606]
Gene: MDM2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6q9ha_ - Heterogens: HRH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>6q9hA (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
Sequence, based on observed residues (ATOM records): (download)
>6q9hA (A:)
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvv