PDB entry 6q82

View 6q82 on RCSB PDB site
Description: Crystal structure of the biportin Pdr6 in complex with RanGTP
Class: protein transport
Keywords: Importin-Beta family, biportin, nuclear transport, GTPase, PROTEIN TRANSPORT
Deposited on 2018-12-14, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin beta-like protein KAP122
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: KAP122, PDR6, YGL016W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (64)
    Domains in SCOPe 2.07: d6q82b_
  • Heterogens: GTP, MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6q82B (B:)
    gepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvw
    dtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkv
    dikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6q82B (B:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefva