PDB entry 6q79

View 6q79 on RCSB PDB site
Description: structure of fucosylated d-antimicrobial peptide sb4 in complex with the fucose-binding lectin pa-iil at 2.009 angstrom resolution
Deposited on 2018-12-13, released 2019-03-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fucose-binding lectin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: lecB, C0043_24310, C0044_25260, C0046_23510, CAZ10_21840, CW299_25270, DI492_13230, DT376_00595, PAERUG_E15_London_28_01_14_00983, PAMH19_1713, RW109_RW109_02453
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A069Q9V4 (0-113)
• Chain 'B':
  Compound: Fucose-binding lectin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: lecB, C0043_24310, C0044_25260, C0046_23510, CAZ10_21840, CW299_25270, DI492_13230, DT376_00595, PAERUG_E15_London_28_01_14_00983, PAMH19_1713, RW109_RW109_02453
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A069Q9V4 (0-113)
• Chain 'C':
  Compound: Fucose-binding lectin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: lecB, C0043_24310, C0044_25260, C0046_23510, CAZ10_21840, CW299_25270, DI492_13230, DT376_00595, PAERUG_E15_London_28_01_14_00983, PAMH19_1713, RW109_RW109_02453
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A069Q9V4 (0-113)
• Chain 'D':
  Compound: Fucose-binding lectin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: lecB, C0043_24310, C0044_25260, C0046_23510, CAZ10_21840, CW299_25270, DI492_13230, DT376_00595, PAERUG_E15_London_28_01_14_00983, PAMH19_1713, RW109_RW109_02453
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A069Q9V4 (0-113)
• Chain 'E':
  Compound: sb4
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'F':
  Compound: SB4 incomplete
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'G':
  Compound: SB4 incomplete
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'H':
  Compound: sb4
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: CA, ZDC, NH2, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6q79A (A:)
  atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
  gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6q79B (B:)
  atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
  gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6q79C (C:)
  atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
  gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >6q79D (D:)
  atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
  gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.