PDB entry 6q6w

View 6q6w on RCSB PDB site
Description: structure of fucosylated d-antimicrobial peptide sb5 in complex with the fucose-binding lectin pa-iil at 1.438 angstrom resolution
Deposited on 2018-12-12, released 2019-03-20
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, C0043_24310, C0044_25260, C0046_23510, CAZ10_21840, CW299_25270, DI492_13230, DT376_00595, PAERUG_E15_London_28_01_14_00983, PAMH19_1713, RW109_RW109_02453
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: sb5
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: CA, ZDC, NH2, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6q6wA (A:)
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

  • Chain 'B':
    No sequence available.