PDB entry 6q5v

View 6q5v on RCSB PDB site
Description: 1-cys siprx, a prx6-family 1-cys peroxiredoxin of the thermoacidophilic archaeon sulfolobus islandicus
Deposited on 2018-12-09, released 2019-05-29
The last revision was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: peroxiredoxin
    Species: Sulfolobus islandicus (strain REY15A) [TaxId:930945]
    Gene: SiRe_0346
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6q5vA (A:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vA (A:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6q5vB (B:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vB (B:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6q5vC (C:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vC (C:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6q5vD (D:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vD (D:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6q5vE (E:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vE (E:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6q5vF (F:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vF (F:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6q5vG (G:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vG (G:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6q5vH (H:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vH (H:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6q5vI (I:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vI (I:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6q5vJ (J:)
    msegripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskky
    eefkklnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaess
    tatvravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneli
    gdkvinpaprtikdakmrlgqpfdwwftykevktt
    

    Sequence, based on observed residues (ATOM records):
    >6q5vJ (J:)
    ripligekfpemevitthgkiklpddykgrwfvlfshpgdftpvcttefysfskkyeefk
    klnteliglsvdsnishiewvmwieknlkvevpfpiiadpmgnvakrlgmihaesstatv
    ravfiiddkgtvrlilyypmeigrnideilrairalqlvdkagvvtpanwpnneligdkv
    inpaprtikdakmrlgqpfdwwftykev