PDB entry 6q44

View 6q44 on RCSB PDB site
Description: est3 telomerase subunit in the yeast hansenula polymorpha
Deposited on 2018-12-05, released 2019-12-25
The last revision was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Ogataea parapolymorpha DL-1 [TaxId:871575]
    Gene: HPODL_02192
    Database cross-references and differences (RAF-indexed):
    • Uniprot W1QJK4 (4-177)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6q44A (A:)
gamgppssrdavrvtasahmkhwlepvlceaglghnykvdkvlkvlriyprsntlsslpl
clcdanykilafanykaiaaferkerrrvtqnllnseimihsftirfynddqvqgffdgl
kfkqkaslfpgylvleindfsmfnrdqlilsnagtieflygtpryiarfieqefsdee