PDB entry 6q3t

View 6q3t on RCSB PDB site
Description: Structure of Protease1 from Pyrococcus horikoshii at room temperature in ChipX microfluidic device
Class: hydrolase
Keywords: ChipX, nucleation, Xo4, Crystallophore, Room temperature, Counterdiffusion, HYDROLASE
Deposited on 2018-12-04, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease1
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Q3T (0-165)
    Domains in SCOPe 2.07: d6q3ta_
  • Chain 'B':
    Compound: Protease1
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Q3T (0-165)
    Domains in SCOPe 2.07: d6q3tb_
  • Chain 'C':
    Compound: Protease1
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • PDB 6Q3T (0-165)
    Domains in SCOPe 2.07: d6q3tc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6q3tA (A:)
    mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
    efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6q3tB (B:)
    mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
    efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6q3tC (C:)
    mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
    efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk