PDB entry 6q2w

View 6q2w on RCSB PDB site
Description: Crystal structure of human ROR gamma LBD in complex with a quinoline sulfonamide inverse agonist
Class: transcription
Keywords: ROR gamma, inverse agonist, nuclear hormone receptor, transcription
Deposited on 2018-12-03, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6q2wa_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6q2wb_
  • Heterogens: HBW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6q2wA (A:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6q2wB (B:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6q2wB (B:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlckthrqsilaklppkgklrslcsqhverlqif