PDB entry 6q1m

View 6q1m on RCSB PDB site
Description: Crystal structure of the wheat dwarf virus Rep domain
Class: replication
Keywords: HUH-tag, HUH motif, Rep domain, viral protein, single stranded DNA, ssDNA, ssDNA binding, REPLICATION
Deposited on 2019-08-05, released 2019-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication-associated protein
    Species: Wheat dwarf virus [TaxId:10834]
    Gene: REPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6q1ma_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6q1mA (A:)
massstprfrvyskylfltypqctlepqyaldslrtllnkyeplyiaavrelhedgsphl
hvlvqnklrasitnpnalnlrmdtspfsifhpniqaakdcnqvrdyitkevdsdvntaew
gtfvavstpgrkdrdad

    Sequence, based on observed residues (ATOM records): (download) 
    >6q1mA (A:)
frvyskylfltypqctlepqyaldslrtllnkyeplyiaavrelhedgsphlhvlvqnkl
rasitnpnalnlrmdtspfsifhpniqaakdcnqvrdyitkevdsdvntaewgtfvavs