PDB entry 6pxc

View 6pxc on RCSB PDB site
Description: n-terminal sh2 domain of the p120rasgap bound to a p190rhogap phosphotyrosine peptide
Deposited on 2019-07-25, released 2019-12-18
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (2-End)
      • engineered mutation (64)
      • engineered mutation (89)
  • Chain 'U':
    Compound: phosphopeptide of p190RhoGAP
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PXC
  • Heterogens: PTR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6pxcA (A:)
gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved

    Sequence, based on observed residues (ATOM records):
    >6pxcA (A:)
tapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfrii
amsgdyyiggrrfsslsdligyyshvssllkgekllypvappep

  • Chain 'U':
    Sequence, based on SEQRES records:
    >6pxcU (U:)
eeeniysvphdst

    Sequence, based on observed residues (ATOM records):
    >6pxcU (U:)
eeeniysvphds