PDB entry 6pxb

View 6pxb on RCSB PDB site
Description: N-Terminal SH2 domain of the p120RasGAP
Class: signaling protein
Keywords: SH2 GTPase Activating Proteins Ras pathway SIGNALING PROTEIN, SIGNALING PROTEIN
Deposited on 2019-07-25, released 2019-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (Start-108)
      • engineered mutation (64)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6pxba_
  • Chain 'B':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (Start-108)
      • engineered mutation (64)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6pxbb_
  • Chain 'C':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (Start-108)
      • engineered mutation (64)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6pxbc_
  • Chain 'D':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (Start-108)
      • engineered mutation (64)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6pxbd_
  • Chain 'E':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (Start-108)
      • engineered mutation (64)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6pxbe_
  • Chain 'F':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, GAP, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (Start-108)
      • engineered mutation (64)
      • engineered mutation (89)
    Domains in SCOPe 2.07: d6pxbf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6pxbA (A:)
    gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
    iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pxbA (A:)
    tnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsg
    dyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6pxbB (B:)
    gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
    iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pxbB (B:)
    qwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsgdy
    yiggrrfsslsdligyyshvssllkgekllypvappepved
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6pxbC (C:)
    gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
    iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pxbC (C:)
    tnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsg
    dyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6pxbD (D:)
    gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
    iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pxbD (D:)
    qwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsgdy
    yiggrrfsslsdligyyshvssllkgekllypvappepved
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6pxbE (E:)
    gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
    iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pxbE (E:)
    nqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsgd
    yyiggrrfsslsdligyyshvssllkgekllypvappepved
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6pxbF (F:)
    gstapptnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfr
    iiamsgdyyiggrrfsslsdligyyshvssllkgekllypvappepved
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pxbF (F:)
    tnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsg
    dyyiggrrfsslsdligyyshvsslgekllypvappepved