PDB entry 6pwz

View 6pwz on RCSB PDB site
Description: Crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidocytidine
Class: transferase/transferase inhibitor
Keywords: uridine cytidine kinase, nucleotide binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2019-07-24, released 2020-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwza_
  • Chain 'B':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwzb_
  • Chain 'C':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwzc_
  • Chain 'D':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwzd_
  • Chain 'E':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwze_
  • Chain 'F':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwzf_
  • Chain 'G':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwzg_
  • Chain 'H':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pwzh_
  • Heterogens: P6D, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6pwzA (A:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzA (A:)
    gepfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakal
    kgqfnfdhpdafdnelilktlkeitegktvqipvydfvsrkeetvtvypadvvlfegila
    fysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclp
    tkkyadviiprgadnlvainlivqhiqdilngg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6pwzB (B:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzB (B:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilnggp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6pwzC (C:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzC (C:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdiln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6pwzD (D:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzD (D:)
    gepfligvsggtasgkssvcakivqllgqndyrqkqvvilsqdsfyrvltseqkakalkg
    qfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegila
    fysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclp
    tkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6pwzE (E:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzE (E:)
    gepfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakal
    kgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegi
    lafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefc
    lptkkyadviiprgadnlvainlivqhiqdiln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6pwzF (F:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzF (F:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6pwzG (G:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzG (G:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6pwzH (H:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pwzH (H:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvkakalkgqfnf
    dhpdafdnelilktlkeitegktvqipvvshsrkeetvtvypadvvlfegilafysqevr
    dlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclptkkyadv
    iiprgadnlvainlivqhiqdilng