PDB entry 6pvw

View 6pvw on RCSB PDB site
Description: RNase A in complex with cp4pA
Class: lyase
Keywords: RNase A, nucleotide, poly-phosphate, metaphosphate, LYASE
Deposited on 2019-07-21, released 2019-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pvwa_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pvwb_
  • Heterogens: P0J, OZV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6pvwA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6pvwB (B:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv