PDB entry 6pv0

View 6pv0 on RCSB PDB site
Description: backbone-modified variant of zinc finger 2 from the transcription factor sp1 dna binding domain: d-pro in the metal-binding turn
Deposited on 2019-07-19, released 2020-06-24
The last revision was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor Sp1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08047 (0-30)
      • variant (3)
      • variant (7-8)
  • Heterogens: DPR, ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6pv0A (A:)
    rpflctwpgcgkrftrsdelqrhkrthtgek