PDB entry 6pt7

View 6pt7 on RCSB PDB site
Description: Structure of KatE1 catalase from Acinetobacter sp. Ver3
Class: oxidoreductase
Keywords: catalase, peroxide, NADP, cold-adapted, OXIDOREDUCTASE
Deposited on 2019-07-15, released 2020-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Acinetobacter sp. Ver3 [TaxId:466088]
    Gene: CL42_01515
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pt7a_
  • Heterogens: HEM, NAP, OMT, CL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pt7A (A:)
    kcpvthlttdagapvvdnqnsmtagargpllaqdlwlneklgnfvreviperrmhakgsg
    afgtftvthditqytraklfseigkktdifvrfstvagergaadaerdirgfamkfytee
    gnwdlvgnntpvfflrdarkfpdlnkavkrdpktnkrsatnnwdfwtllpealhqvtivm
    sdrgipdgyrhmhgfgshtfsfinannerfwvkfhmrtqqgiknltdaeaeaiiakdres
    sqtdlfdaiergdfpkwkmyvqimpeldaekvpyhpfdltkvwpkgdyplievgefelnr
    npenyfqdveqaafapsnlvpgisfspdrmlqarlfnyadaaryrvgvnhyqipvnaprc
    pvhsnrrdgqgrtdgnygalphyepnsfsqwqeqpqykepplkisgaadfwdyreddndy
    fsqpralfnlmndqqkqalfdntaaamgdaldfikyrhirncyacdpaygegvakalgmt
    vadaqaaratdpaqgnpgll