PDB entry 6psh

View 6psh on RCSB PDB site
Description: crystal structure of periplasmic domain of antiholin ri from t4 phage
Deposited on 2019-07-12, released 2020-06-24
The last revision was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antiholin
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: rI, 58.6, rIA, tk.-2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6pshA (A:)
mnvdphfdkfmesgirhvymlfenksvesseqfysfmrttykndpcssdfeciergaema
qsyarimnikleteklaaalehhhhhh

    Sequence, based on observed residues (ATOM records):
    >6pshA (A:)
nvdphfdkfmesgirhvymlfenksvesseqfysfmrttykndpcssdfeciergaemaq
syarimnikl