PDB entry 6psa

View 6psa on RCSB PDB site
Description: pie12 d-peptide against hiv entry (in complex with iqn17 q577r resistance mutant)
Deposited on 2019-07-12, released 2020-02-05
The last revision was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iqn17
    Species: HUMAN IMMUNODEFICIENCY VIRUS TYPE 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-27)
      • conflict (4)
      • conflict (8)
      • conflict (11-12)
      • conflict (15-18)
      • conflict (22)
      • conflict (25)
    • Uniprot P04578 (28-44)
      • engineered mutation (40)
  • Chain 'H':
    Compound: PIE12 D-peptide
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6psaA (A:)
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlraril

  • Chain 'H':
    No sequence available.