PDB entry 6prq

View 6prq on RCSB PDB site
Description: structural basis for client recognition and activity of hsp40 chaperones
Deposited on 2019-07-10, released 2019-09-18
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline phosphatase,Chaperone protein DnaJ 2 fusion
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: dnaJ2, TTHA1489
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-8)
      • linker (9-19)
    • Uniprot Q56237 (20-160)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6prqA (A:)
    aalvahvtsgsggsggsggsgrdlraelpltleeafhggervvevagrrvsvrippgvre
    gsvirvpgmggqgnppgdlllvvrllphpvfrlegqdlyatldvpapiavvggkvramtl
    egpvevavpprtqagrklrlkgkgfpgpagrgdlylevrit