PDB entry 6pr7

View 6pr7 on RCSB PDB site
Description: S. aureus dihydrofolate reductase co-crystallized with benzyl-dihydropthalazine inhibitor and NADP(H)
Class: oxidoreductase/inhibitor
Keywords: dihydrofolate reductase, oxidoreductase-inhibitor complex
Deposited on 2019-07-10, released 2020-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-17, with a file datestamp of 2020-06-12.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A017 (0-158)
      • expression tag (159-162)
    Domains in SCOPe 2.08: d6pr7a1, d6pr7a2
  • Heterogens: OWP, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pr7A (A:)
    mtlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrn
    vvltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrg
    dtffppytfedwevassvegkldekntiphtflhlirkklvpr