PDB entry 6pqt

View 6pqt on RCSB PDB site
Description: n-terminal domain of dynein intermediate chain from chaetomium thermophilum
Deposited on 2019-07-10, released 2020-08-19
The last revision was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein intermediate chain protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0056990
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SCF1 (4-91)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6pqtA (A:)
gahmmqarreellakkarlaeikrqrelraqqaagrsitpselvsptpsransrreiesl
idsilsssagansprrgsrpnsvistgelstd