PDB entry 6pq2

View 6pq2 on RCSB PDB site
Description: structural basis for client recognition and activity of hsp40 chaperones
Deposited on 2019-07-08, released 2019-09-18
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline phosphatase,Chaperone DnaJ domain-containing protein fusion
    Species: Thermus thermophilus [TaxId:274]
    Gene: TTMY_2110
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (1-10)
      • initiating methionine (0)
      • linker (11-21)
    • Uniprot A0A1J1EK86 (22-89)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6pq2A (A:)
mlpllftpvtkgsggsggsggsgrdlraelpltleeafhggervvevagrrvsvrippgv
regsvirvpgmggqgnppgdlllvvrllph