PDB entry 6ppw

View 6ppw on RCSB PDB site
Description: crystal structure of neub, an n-acetylneuraminate synthase from neisseria meningitidis, in complex with magnesium and malate
Deposited on 2019-07-08, released 2019-10-02
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylneuraminate synthase
    Species: Neisseria meningitidis serogroup B [TaxId:491]
    Gene: synC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, MLT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.02, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6ppwA (A:)
    mqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthive
    demsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrl
    qrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyall
    hctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdr
    mdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdik
    kgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie
    

    Sequence, based on observed residues (ATOM records):
    >6ppwA (A:)
    qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
    emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
    rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
    ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
    drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiagekptkdfafasvvadkdikk
    gellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkgaqikktdie