PDB entry 6pny

View 6pny on RCSB PDB site
Description: x-ray structure of flpp3
Deposited on 2019-07-03, released 2020-02-26
The last revision was dated 2020-05-20, with a file datestamp of 2020-05-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flpp3
    Species: Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) [TaxId:177416]
    Gene: BZ14_1359
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A454XXY1 (11-118)
      • expression tag (3-10)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6pnyA (A:)
mhhhhhhiegrqykdgyyittlnynfntvynatlqaiqngqtfdyksnpydisvnknngt
daeivsasdsdstdslqvamkklpnnatrisikygsqgnsirssaligiiegniryant

    Sequence, based on observed residues (ATOM records):
    >6pnyA (A:)
hhhhiegrqykdgyyittlnynfntvynatlqaiqngqtfdyksnpydisvnknngtdae
ivsasdsdstdslqvamkklpnnatrisikygsqgnsirssaligiiegniryant