SCOPe 2.08: Structural Classification of Proteins

PDB entry 6phe

View 6phe on RCSB PDB site
Description: Crystal structure of Methylglyoxal synthase from Elizabethkingia anophelis NUHP1
Class: lyase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, NUHP1, LYASE
Deposited on 2019-06-25, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phea_
Chain 'B':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6pheb_
Chain 'C':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phec_
Chain 'D':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phed_
Chain 'E':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phee_
Chain 'F':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phef_
Chain 'G':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6pheg_
Chain 'H':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6pheh_
Chain 'I':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phei_
Chain 'J':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phej_
Chain 'K':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phek_
Chain 'L':
Compound: methylglyoxal synthase
Species: Elizabethkingia anophelis NUHP1 [TaxId:1338011]
Gene: mgsA, BD94_2272
Database cross-references and differences (RAF-indexed):
- Uniprot A0A077EEZ5 (Start-160)
Domains in SCOPe 2.08: d6phel_
Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6pheA (A:)
mahhhhhhmksirtlperktialvahdhkkddlvrwvqkhagkltkhnliatgttgklie
edlgvevkrvmsgplggdqqlgsmiaqrqidiviffwdpmeaqphdsdvkafirlcvvwn
tpmacdsatadfilsspfmeteyqaeipdydgylkrnipea