PDB entry 6pdl

View 6pdl on RCSB PDB site
Description: Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor Ephrin-B2
Class: viral protein/signaling protein
Keywords: attachment, glycoprotein, G protein, VIRAL PROTEIN, receptor, VIRAL PROTEIN-SIGNALING PROTEIN complex
Deposited on 2019-06-19, released 2019-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Attachment glycoprotein
    Species: Hendra henipavirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNB2, EPLG5, HTKL, LERK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6pdlb_
  • Chain 'C':
    Compound: Attachment glycoprotein
    Species: Hendra henipavirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNB2, EPLG5, HTKL, LERK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6pdld_
  • Chain 'E':
    Compound: Attachment glycoprotein
    Species: Hendra henipavirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNB2, EPLG5, HTKL, LERK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6pdlf_
  • Chain 'G':
    Compound: Attachment glycoprotein
    Species: Hendra henipavirus [TaxId:63330]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNB2, EPLG5, HTKL, LERK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6pdlh_
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6pdlB (B:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pdlB (B:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvqyeyykvymvdkdqadrctik
    ntpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqeggvcq
    tramkilmkvgqd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6pdlD (D:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pdlD (D:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikntpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnq
    eggvcqtramkilmkvgqd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6pdlF (F:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pdlF (F:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvqyeyykvymvdkdqadrctik
    ntpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqeggvcq
    tramkilmkvgqd
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6pdlH (H:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pdlH (H:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikntpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnq
    eggvcqtramkilmkvgqd