PDB entry 6pd5

View 6pd5 on RCSB PDB site
Description: Crystal Structure of a H5N1 influenza virus hemagglutinin at pH 6.5
Class: viral protein
Keywords: Influenza, H5, VIRAL PROTEIN
Deposited on 2019-06-18, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Vietnam/4/2003(H5N1)) [TaxId:380835]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1KHJ8 (15-End)
      • expression tag (12-14)
    Domains in SCOPe 2.07: d6pd5a1, d6pd5a2, d6pd5a3
  • Heterogens: SO4, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6pd5A (A:)
    llaaaahsafaadpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdld
    gvkplilrdcsvagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhll
    srinhfekiqiipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsyn
    ntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgr
    meffwtilkpndainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgai
    nssmpfhnihpltigecpkyvksnrlvlatglrnspqrerrrkkrglfgaiagfieggwq
    gmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmntqfeavgrefnnler
    rienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydkvrlqlrdnakelgn
    gcfefyhkcdnecmesvrngtydypqyseearlkreeisgsrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pd5A (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsaiagfieggwqgmvdgwygyhhsneqgsgyaadkest
    qkaidgvtnkvnsiidkmntqfeavgrefnnlerrienlnkkmedgfldvwtynaellvl
    menertldfhdsnvknlydkvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypq
    yseearlkree