PDB entry 6pcy

View 6pcy on RCSB PDB site
Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Deposited on 1986-09-02, released 1987-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.152
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d6pcy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6pcy_ (-)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn