PDB entry 6pcu

View 6pcu on RCSB PDB site
Description: VP8* of a G2P[4] human rotavirus in complex with scFv antibody 9
Class: viral protein/immune system
Keywords: rotavirus, VIRAL PROTEIN, antibody, scFv, viral protein-immune system complex
Deposited on 2019-06-18, released 2019-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-04, with a file datestamp of 2019-08-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2VE61 (2-161)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6pcua1, d6pcua2
  • Chain 'B':
    Compound: Variable domain of antibody scFv9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PCU (Start-117)
    Domains in SCOPe 2.07: d6pcub_
  • Chain 'C':
    Compound: Variable domain of antibody scFv9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PCU (0-End)
    Domains in SCOPe 2.07: d6pcuc1, d6pcuc2
  • Chain 'D':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2VE61 (2-161)
      • expression tag (1)
    Domains in SCOPe 2.07: d6pcud1, d6pcud2
  • Chain 'E':
    Compound: Variable domain of antibody scFv9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PCU (Start-117)
    Domains in SCOPe 2.07: d6pcue_
  • Chain 'F':
    Compound: Variable domain of antibody scFv9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PCU (0-118)
    Domains in SCOPe 2.07: d6pcuf1, d6pcuf2
  • Chain 'G':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2VE61 (2-161)
      • expression tag (1)
    Domains in SCOPe 2.07: d6pcug1, d6pcug2
  • Chain 'H':
    Compound: Variable domain of antibody scFv9 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PCU (Start-117)
    Domains in SCOPe 2.07: d6pcuh_
  • Chain 'I':
    Compound: Variable domain of antibody scFv9 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6PCU (0-118)
    Domains in SCOPe 2.07: d6pcui1, d6pcui2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pcuA (A:)
    gsildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvl
    fgenkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetp
    rattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6pcuB (B:)
    gsqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgs
    kgdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pcuB (B:)
    sqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgsk
    gdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6pcuC (C:)
    qvqlqesgpglvkpsqtlsltcsvsgvslsggsytwnwirqpagkglewigriftsgstn
    ynpslkgrltmsidtsknqlslrlssvtaadtavyycvadyyysvpdvwgqgtpvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pcuC (C:)
    qvqlqesgpglvkpsqtlsltcsvsgvslsggsytwnwirqpagkglewigriftsgstn
    ynpslkgrltmsidtsknqlslrlssvtaadtavyycvadyyysvpdvwgqgtpvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6pcuD (D:)
    gsildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvl
    fgenkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetp
    rattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pcuD (D:)
    sildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvlf
    genkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetpr
    attdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6pcuE (E:)
    gsqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgs
    kgdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pcuE (E:)
    sqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgsk
    gdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pcuF (F:)
    qvqlqesgpglvkpsqtlsltcsvsgvslsggsytwnwirqpagkglewigriftsgstn
    ynpslkgrltmsidtsknqlslrlssvtaadtavyycvadyyysvpdvwgqgtpvtvss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6pcuG (G:)
    gsildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvl
    fgenkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetp
    rattdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pcuG (G:)
    sildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvlf
    genkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetpr
    attdssntadlnnisiiihsefyiiprsqeskcneyinngl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6pcuH (H:)
    gsqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgs
    kgdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6pcuH (H:)
    sqpvltqppsasaslgasvtltctlssgysnykvdwyqqrpgkgprfvmrvgtggivgsk
    gdgiadrfsvsgsglnrsltikniqeedesdyhcgadhgsgdnfvrvfgggtkltvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6pcuI (I:)
    qvqlqesgpglvkpsqtlsltcsvsgvslsggsytwnwirqpagkglewigriftsgstn
    ynpslkgrltmsidtsknqlslrlssvtaadtavyycvadyyysvpdvwgqgtpvtvss