PDB entry 6pce

View 6pce on RCSB PDB site
Description: human coa6
Deposited on 2019-06-17, released 2019-10-02
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase assembly factor 6 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: COA6, C1orf31
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cytochrome c oxidase assembly factor 6 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: COA6, C1orf31
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6pceA (A:)
psmkerqvcwgardeywkcldenledasqckklrssfesscpqqwikyfdkrrdylkfke
kfeagqfeps

    Sequence, based on observed residues (ATOM records):
    >6pceA (A:)
mkerqvcwgardeywkcldenledasqckklrssfesscpqqwikyfdkrrdylkfkekf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6pceB (B:)
psmkerqvcwgardeywkcldenledasqckklrssfesscpqqwikyfdkrrdylkfke
kfeagqfeps