PDB entry 6pbo

View 6pbo on RCSB PDB site
Description: Staphylococcus aureus Dihydrofolate reductase in complex with NADPH and UCP1232
Class: antimicrobial protein
Keywords: DHFR, methotrexate, antifolate, NADPH, ANTIMICROBIAL PROTEIN
Deposited on 2019-06-14, released 2019-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6pbox_
  • Heterogens: O71, XNP, NAP, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6pboX (X:)
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk