PDB entry 6paz

View 6paz on RCSB PDB site
Description: oxidized mutant p80i pseudoazurin from a. faecalis
Deposited on 1997-02-21, released 1997-08-20
The last revision prior to the SCOP 1.59 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d6paz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6paz_ (-)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctihyamgmialiavgdspanldqivsakkpkivqerlekvia
sak