PDB entry 6pax

View 6pax on RCSB PDB site
Description: crystal structure of the human pax-6 paired domain-DNA complex reveals a general model for pax protein-DNA interactions
Class: gene regulation/DNA
Keywords: pax, paired domain, transcription, protein-DNA interactions, gene regulation/DNA complex
Deposited on 1999-04-22, released 1999-07-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: homeobox protein pax-6
  Species: Homo sapiens [TaxId:9606]
  Gene: PAX6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26367 (0-132)
    • conflict (24)
    • conflict (58)
    • conflict (88)
  Domains in SCOPe 2.05: d6paxa1, d6paxa2
• Chain 'B':
  Compound: 26 nucleotide DNA
  
• Chain 'C':
  Compound: 26 nucleotide DNA
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6paxA (A:)
  shsgvnqlggvfvngrplpdstrqrivelahsgarpcdisrilqvsngcvskilgryyat
  gsirpraiggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssi
  nrvlrnlasekqq
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.